Everything below concerns freeze-thaw. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-03-30. Numbers and descriptions here follow the published literature rather than marketing material.
Lyophilised semaglutide is generally held at -20 °C or below, protected from light and moisture. Reconstituted solutions are typically kept at 2-8 °C and used within a defined window because degradation accumulates over time. Repeated freeze-thaw cycles are discouraged, since each cycle can promote aggregation and reduce monomeric content. Room-temperature stability of the solid has been examined in some studies but remains incompletely characterised for long durations, so cold storage is the conservative default for research material.
Degradation proceeds along several parallel routes. Deamidation of asparagine and glutamine residues generates charged variants that shift retention time in chromatographic analysis. Oxidation targets methionine and can be accelerated by trace metals or dissolved oxygen. Non-covalent aggregation produces dimers, oligomers, and larger species that are difficult to reverse. Isomerisation at aspartate residues is slower but measurable under thermal stress. The distribution among these pathways depends on pH, buffer composition, ionic strength, and the presence of excipients such as sugars or surfactants.
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 nm is the standard purity method, reported as area percent. Mass spectrometry, usually with electrospray ionisation, confirms identity and reveals covalent modifications. Size-exclusion chromatography quantifies aggregates and fragments. Peptide mapping after enzymatic digestion localises changes to specific sequence regions. Circular dichroism and infrared spectroscopy report on secondary structure, while light scattering tracks particle formation in liquid formulations. No single technique captures every quality attribute.
Semaglutide dissolves readily in water and in aqueous buffers near neutral pH. Solubility decreases near the isoelectric point, where net charge is minimal. Common laboratory solvents include phosphate-buffered saline and dilute ammonium bicarbonate. Strongly acidic or basic conditions may accelerate hydrolysis. Working concentrations are usually prepared by diluting a concentrated stock. Vial surfaces can adsorb small amounts of peptide at low concentrations, so carrier proteins or low-binding tubes are sometimes used.
Reverse-phase high-performance liquid chromatography is the standard method for purity assessment, separating the peptide from truncated or oxidized variants. Mass spectrometry confirms molecular mass and detects modifications, while ultraviolet absorbance near 280 nanometers supports concentration measurement through tryptophan and tyrosine residues. Circular dichroism can indicate secondary structure, though the peptide is largely helical in solution, and ion-exchange chromatography resolves charge variants. Purity values above 95 percent are typical for research-grade material. Stability studies track degradation over time under defined conditions.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white lyophilised powder | visual inspection of solid |
| Solubility | Freely soluble in water, pH dependent | buffer choice affects clarity |
| Typical storage | -20 °C, desiccated, protected from light | solution form kept at 2-8 °C |
| Primary purity method | RP-HPLC with UV detection, 214-220 nm | reported as area percent |
| Identity confirmation | LC-ESI-MS, approximately 4114 Da | compared with theoretical mass |
Material described as research-grade is not necessarily manufactured to pharmaceutical standards, and purity figures depend on the method used to obtain them. A certificate of analysis states the measured purity, the analytical technique, and the batch identifier, but the underlying data are not always included. Independent testing by a second laboratory is a common way to confirm identity and purity. Uncertainties remain about how storage history affects long-term stability, and about how well results from one laboratory transfer to another. Documentation of handling conditions supports comparison between batches.
Peptides are sensitive to temperature, light, oxygen, and repeated freeze-thaw cycles. Semaglutide in dry form is generally held at refrigerated temperatures, while reconstituted solutions require a defined short-term storage window. Vials should be kept in secondary packaging to limit photodegradation, and exposure to alkaline conditions is avoided because it accelerates chemical degradation. Adsorption to glass and some plastics can reduce the measured concentration of dilute solutions, so low-binding polypropylene containers are preferred for analytical work. Each transfer step introduces a small risk of contamination, and closed handling practices reduce that risk.
Two structural features account for the prolonged half-life of semaglutide. A modified amino acid at position 8 resists cleavage by dipeptidyl peptidase-4, the enzyme that rapidly degrades native GLP-1. A fatty diacid side chain binds serum albumin, which limits renal clearance and protects the peptide from enzymatic breakdown. These modifications yield a plasma half-life of approximately one week in humans, allowing once-weekly administration. The relationship between plasma concentration and clinical effect varies between individuals, and sources of that variability are still being characterized.
Semaglutide is a synthetic peptide analog of glucagon-like peptide-1 (GLP-1), a hormone released from intestinal L-cells after food intake. The compound belongs to the incretin mimetic class and acts at GLP-1 receptors distributed across pancreatic, gastrointestinal, cardiovascular, and central nervous system tissues. Compared with native GLP-1, the molecule carries structural changes that extend its activity from minutes to roughly one week. It is studied for glycemic control in type 2 diabetes and for weight management, and its effects on cardiovascular and other outcomes remain active research areas.
Noteworthy side effects include dry mouth, headache, fatigue, dizziness, intermittent facial oedema, nausea, sleep disturbances (rarely sedation), asthenia, vasodilatation, and rarely, skin reactions.
The OECD Economic Outlook, published twice a year, with interim updates. It provides analysis and forecasts of major short-term global economic trends including for GDP growth, inflation and labour market developments across member and selected partner countries. The OECD Economic Outlook helps policymakers assess near-term economic prospects, risks and policy options. The Main Economic Indicators, published monthly. It contains a large selection of timely statistical indicators. The OECD Communications Outlook and the OECD Internet Economy Outlook (formerly the Information Technology Outlook), which rotate every year. They contain forecasts and analysis of the communications and information technology industries in OECD member countries and non-member economies. In 2007 the OECD published Human Capital: How what you know shapes your life, the first book in the OECD Insights series. This series uses OECD analysis and data to introduce important social and economic issues to non-specialist readers. Other books in the series cover sustainable development, international trade and international migration. The series was discontinued in 2017. All OECD books are available on www.OECD.org.
N-Acetylcysteine ethyl ester (NACET, NAC-Et) is an antioxidant which acts as a lipophilic prodrug for N-acetylcysteine and subsequently glutathione, with improved bioavailability over N-acetylcysteine itself, and has been researched in animal studies as a potential treatment for diabetic retinopathy. It has also been sold as a "dietary supplement" in combination with glycine under the name GlyNAC-Et as a supposedly improved version of the older glycine-NAC combination GlyNAC which has been claimed to show efficacy in counteracting symptoms associated with aging as well as HIV infection, diabetes and nerve damage. Several related compounds such as γ-glutamylcysteine ethyl ester and glutathione ethyl ester have been investigated for similar applications.
==== Small RNA ==== At first, regulatory RNA was thought to be a eukaryotic phenomenon, a part of the explanation for why so much more transcription in higher organisms was seen than had been predicted. But as soon as researchers began to look for possible RNA regulators in bacteria, they turned up there as well, termed as small RNA (sRNA). Currently, the ubiquitous nature of systems of RNA regulation of genes has been discussed as support for the RNA World theory. There are indications that the enterobacterial sRNAs are involved in various cellular processes and seem to have significant role in stress responses such as membrane stress, starvation stress, phosphosugar stress and DNA damage. Also, it has been suggested that sRNAs have been evolved to have important role in stress responses because of their kinetic properties that allow for rapid response and stabilisation of the physiological state. Bacterial small RNAs generally act via antisense pairing with mRNA to down-regulate its translation, either by affecting stability or affecting cis-binding ability. Riboswitches have also been discovered. They are cis-acting regulatory RNA sequences acting allosterically. They change shape when they bind metabolites so that they gain or lose the ability to bind chromatin to regulate expression of genes.
Sources: en.wikipedia.org
==== Elimination ==== The drug is eliminated mainly by the kidneys. A single oral dose of methenamine is excreted 70 to 90% in urine unchanged within 24 hours. The onset of action of the urinary antibacterial effects of methenamine is within 30 minutes. A urinary formaldehyde concentration of 18 to 60 μg/mL can be achieved with a typical therapeutic dosage of methenamine and these concentrations of formaldehyde can inhibit almost all urinary pathogens. The elimination half-life of methenamine is 2 to 6 hours.
==== Revelation of Dimeric Structure and Oligomeric Structure ==== Cyclooxygenase-2 (COX-2) and microsomal prostaglandin E2 synthase-1 (mPGES-1) structures were studied using both photo-methionine (photo-activatable) and bifunctional cross linkers. Photo-methionine used in COX-2 had shown just as the bifunctional cross-linker that there was a dimeric structure which this was consistent with the crystal structure of the enzyme. In mPGES-1, the human cells (A549) had been treated with disuccinimidyl suberate (chemical cross-linker) had yielded a dimer of 33kDa and a trimer of 45kDa while it was treated with photo-methionine had yielded a dimer of the same molecular weight (33kDa) and two putative trimers (50kDa and 55kDa). Once a mPGES-1 inhibitor (MF63) was introduced; this had inhibited the formation of the 50kDa and 55kDa complexes. The dimer and trimer yielded by the chemical cross-linker was not affected by the inhibitor. Yet, photo-methionine nor disuccinimidyl suberate had not shown any protein-protein interactions between COX-2 and mPGES-1 and this could be due to various reasons. For photo-methionine; one could be due to the low incorporation at this time as it was 0.7%. So, for mPGES-1; this has 152 amino acids so only one photo-methionine would be incorporated per monomer. That also means not one specific methionine would be replaced so that results in a heterogeneous population of mPGES-1 resulting in different cross-linking.
=== Announcement and delay === Valve announced Half-Life 2 at E3 2003, with demonstrations of the characters, animation and physics. The reaction was positive, and the game won the E3 Game of the Show award. Newell also announced a release date of September 30, 2003, hoping this would motivate the team. They worked long hours to meet the deadline, but by July it was clear they would miss it. Rumors spread of a delay. On September 23, Valve released a statement targeting a release for the holiday season, leading to fan backlash. Newell had been hesitant to announce a delay without a new release date. He said later: "We were paralyzed. We knew we weren't going to make the date we promised, and that was going to be a huge fiasco and really embarrassing. But we didn't have a new date to give people either." The graphics card manufacturer ATI had arranged a promotional event on Alcatraz Island to coincide with the planned release of Half-Life 2. Unable to pull out of the event, Newell gave a prepared speech, demonstrated the Source engine, and left without addressing questions.
=== Pharmacodynamics === Although the mechanism of action of valproate is not fully understood, traditionally, its anticonvulsant effect has been attributed to the blockade of voltage-gated sodium channels and increased brain levels of the inhibitory synaptic neurotransmitter gamma-aminobutyric acid (GABA). The GABAergic effect is also believed to contribute towards the anti-manic properties of valproate. In animals, sodium valproate raises cerebral and cerebellar levels of GABA, possibly by inhibiting GABA degradative enzymes, such as GABA transaminase, succinate-semialdehyde dehydrogenase and by inhibiting the re-uptake of GABA by neuronal cells. Prevention of neurotransmitter-induced hyperexcitability of nerve cells via Kv7.2 channel and AKAP5 may also contribute to its mechanism. Valproate has been shown to protect against a seizure-induced reduction in phosphatidylinositol (3,4,5)-trisphosphate (PIP3) as a potential therapeutic mechanism.
The disappointment was mitigated when the composition of the Government was known, in which the most prominent figures of Franco's "reformism" appeared, such as Manuel Fraga Iribarne, José María de Areilza and Antonio Garrigues y Díaz Cañabate. Other Francoist "reformists" from the Catholic (Alfonso Osorio) and Falangist "families" (the "blue reformists", Adolfo Suárez and Rodolfo Martin Villa) also participated in this government. Actually, the members of the government were imposed on Arias Navarro by the king, and in the case of Suárez it had been a suggestion of Fernández Miranda. This new government was often referred to in the press as the "Arias-Fraga-Areilza-Garrigues government".
Sources: en.wikipedia.org
== Synthesis == The synthesis of nanogels can be achieved using a vast array of different methods. However, two critical steps typically included in each method are polymerization and crosslinking, with physical and chemical crosslinking the most common. These steps can be completed concomitantly or in sequential order depending on the synthesis method and eventual nanogel application. Here, several different synthesis mechanisms are described briefly.
=== Kinetics and transduction === The first demonstration that NAADP levels increase in response to an extracellular stimulus arose from studying sea urchin fertilization (NAADP changed in both the eggs and sperm upon contact). Subsequently, other cell types have followed suit, as exemplified by the pancreas (acinar and beta cells), T-cells, and smooth muscle. Levels increase very rapidly — and possibly precede the increase in the other messengers IP3 and cADPR— but can be very transient (spiking and returning to basal levels within seconds). The transduction mechanisms that couple cell stimuli to such NAADP increases are ill-defined, with some suggestions of cyclic AMP or cytosolic Ca2+ itself stimulating synthesis.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
The figures provided in this section on epidemiology all refer to undernutrition even if the term malnutrition is used which, by definition, could also apply to too much nutrition. The Global Hunger Index (GHI) is a multidimensional statistical tool used to describe the state of countries' hunger situation. The GHI measures progress and failures in the global fight against hunger. The GHI is updated once a year. The data from the 2015 report shows that Hunger levels have dropped 27% since 2000. Fifty two countries remain at serious or alarming levels. In addition to the latest statistics on Hunger and Food Security, the GHI also features different special topics each year. The 2015 report include an article on conflict and food security.
== Bibliography == Gasnault, François (2007). Sur les traces de vos ancêtres à Paris [On the trail of your ancestors in Paris] (in French). Paris: Archives de Paris. Abensur-Hazan, Laurence (2011). Recherche ses ancêtres à Paris [Search for ancestors in Paris] (in French). Paris: Autrement généalogies. Barroux, Maurice (1898). Les sources de l'ancien état civil parisien [Parisian civil registry sources] (in French). Paris: Honoré Champion Éditeur. Archived from the original on October 31, 2020. de Blaignerie, Henri; Dangin, Édouard (2009). Paris incendié pendant la Commune - 1871 [Paris set on fire during the Commune - 1871] (in French). Paris: Les Éditions du Mécène. de Brossard, Yolande (1965). Musiciens de Paris 1535-1792, actes d'état civil d'après le fichier Laborde de la Bibliothèque nationale [Musiciens de Paris 1535-1792, civil status records from the Bibliothèque nationale's Laborde file] (in French). Paris: Éditions Picard. de Chastellux, Henri Paul César (1875). Notes prises aux archives de l'état-civil de Paris, avenue Victoria, 4, brûlées le 24 mai 1871 [Notes taken from the archives of the Paris registry office, avenue Victoria, 4, burnt on May 24, 1871] (in French). Paris: Dumoulin. Delsalle, Paul (2009). Histoires de familles, les registres paroissiaux et d'état civil, du Moyen Âge à nos jours, démographie et généalogie [Family histories, parish and civil registers, from the Middle Ages to the present day, demography and genealogy] (in French). Besançon: Presses universitaires de Franche-Comté. Fierro, Alfred (1996).
Sources: en.wikipedia.org
Reverse-phase high-performance liquid chromatography with ultraviolet detection is the usual choice, with results reported as area percent. Complementary methods such as size-exclusion chromatography and mass spectrometry are needed because a single separation cannot resolve every impurity class. Purity figures are therefore method dependent and should always be read alongside the technique used.
Oxidation mainly affects methionine residues and is promoted by dissolved oxygen, trace transition metals, and prolonged exposure to light. Buffer choice and the presence of antioxidants in a formulation can alter the rate appreciably. Because the products differ in mass by only a few units, mass spectrometry is often required to detect them.
Published data on long-term ambient stability are limited, so the question remains open rather than settled. Short excursions during transport are common in practice, and many suppliers use insulated packaging with cold packs. Where stability data are absent, cold-chain handling with temperature logging is the safer approach.
Long-term storage is usually at minus 20 to minus 80 degrees Celsius in a sealed, desiccated container. Working aliquots can be held briefly at 2 to 8 degrees Celsius.